Structure of PDB 4psi Chain A Binding Site BS01

Receptor Information
>4psi Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AHSAALEVLFQGPGQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEFRI
PMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREG
LEDKYNLQLNPEWRMMKNRPFMGSI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4psi Phosphorylation-Dependent PIH1D1 Interactions Define Substrate Specificity of the R2TP Cochaperone Complex.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
P52 K57 K64 D111 A112 K113 M165 K166 N167 R168 I174
Binding residue
(residue number reindexed from 1)
P16 K21 K28 D62 A63 K64 M116 K117 N118 R119 I125
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4psi, PDBe:4psi, PDBj:4psi
PDBsum4psi
PubMed24656813
UniProtQ9NWS0|PIHD1_HUMAN PIH1 domain-containing protein 1 (Gene Name=PIH1D1)

[Back to BioLiP]