Structure of PDB 4prp Chain A Binding Site BS01

Receptor Information
>4prp Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>4prp Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGQADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4prp A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 R62 N63 F67 T73 Y74 S77 N80 Y84 I95 R97 Y99 S116 T143 K146 W147 V152 Q155 Y159 Y171
Binding residue
(residue number reindexed from 1)		Y7 R62 N63 F67 T73 Y74 S77 N80 Y84 I95 R97 Y99 S116 T143 K146 W147 V152 Q155 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links