Structure of PDB 4prh Chain A Binding Site BS01

Receptor Information
>4prh Chain A (length=240) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAPW
IEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGC
DLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAR
VAEQRRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVLRCWALGFYPAE
ITLTQDTELVETRPAGDRTFQKWCHVQHEGLPKPLTLRWE
Ligand information
>4prh Chain C (length=11) Species: 10376 (human gammaherpesvirus 4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGDADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4prh A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y7 Y59 N63 S77 N80 Y84 R97 Y99 S116 T143 W147 A150 V152 Q155 R156 Y159 L163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y6 Y58 N62 S76 N79 Y83 R96 Y98 S115 T142 W146 A149 V151 Q154 R155 Y158 L162 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links