Structure of PDB 4prf Chain A Binding Site BS01

Receptor Information
>4prf Chain A (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK
Ligand information
>4prf Chain B (length=74) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auggccggcauggucccagccuccucgcuggcgccggcugggcaacacca
uugcacuccgguggugaaugggac
..<<<<<<<...((((((<<<.((.....>>>>>>>>>>))....<<<<.
.........>>>>.....))))))
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4prf New tools provide a second look at HDV ribozyme structure, dynamics and cleavage.
Resolution2.395 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 L49 K50 M51 R52 Q54 F56 K80 R83 Q85 Y86 A87 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y10 N12 N13 E16 K19 L46 K47 M48 R49 Q51 F53 K77 R80 Q82 Y83 A84 K85 T86 D87 S88 D89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:4prf, PDBe:4prf, PDBj:4prf
PDBsum4prf
PubMed25326328
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]