Structure of PDB 4pra Chain A Binding Site BS01

Receptor Information
>4pra Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTEPRAP
WIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYG
CDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
>4pra Chain C (length=11) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HPVGQADYFEY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pra A Molecular Basis for the Interplay between T Cells, Viral Mutants, and Human Leukocyte Antigen Micropolymorphism.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 I66 F67 T69 Y74 E76 S77 N80 Y84 R97 Y99 S116 T143 K146 W147 A150 Q155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 N63 I66 F67 T69 Y74 E76 S77 N80 Y84 R97 Y99 S116 T143 K146 W147 A150 Q155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links