Structure of PDB 4po2 Chain A Binding Site BS01

Receptor Information

>4po2 Chain A (length=228) Species: 9606 (Homo sapiens)

ENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQ
PGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGI
LNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRER
VSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANT
LAEKDEFEHKRKELEQVCNPIISGLYQG

Ligand information

>4po2 Chain C (length=7)

NRLLLTG

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4po2 Crystal structure of the stress-inducible human heat shock protein 70 substrate-binding domain in complex with Peptide substrate.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): T405 T411 I427 F428 T429 Y431 Q435 V438 L439 R469 Q473
• Binding residue (residue number reindexed from 1): T20 T26 I42 F43 T44 Y46 Q50 V53 L54 R84 Q88

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Feb 1 05:09:53 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4po2', asym_id = 'A', bs = 'BS01', title = 'Crystal structure of the stress-inducible human ...binding domain in complex with Peptide substrate.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4po2', asym_id='A', bs='BS01', title='Crystal structure of the stress-inducible human ...binding domain in complex with Peptide substrate.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0005524,0140662', uniprot = '', pdbid = '4po2', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005524,0140662', uniprot='', pdbid='4po2', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>