Structure of PDB 4pl8 Chain A Binding Site BS01

Receptor Information
>4pl8 Chain A (length=357) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPSYVGDEAQSKRGILTL
KYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANRE
KMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYE
GYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLC
YVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFI
GMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEI
TALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGP
SIVHRKC
Ligand information
>4pl8 Chain H (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAEIPDMAEIEKFDKSKLKKTETQEK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pl8 Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		G23 D24 D25 A26 P27 R28 A29 V30 Y143 A144 T148 E167 Y337 I345 L349 S350 T351
Binding residue
(residue number reindexed from 1)		G19 D20 D21 A22 P23 R24 A25 V26 Y126 A127 T131 E150 Y320 I328 L332 S333 T334
Enzymatic activity
Enzyme Commision number 3.6.4.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003785 actin monomer binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005523 tropomyosin binding
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0019904 protein domain specific binding
GO:0031013 troponin I binding
GO:0031432 titin binding
GO:0032036 myosin heavy chain binding
GO:0042802 identical protein binding
GO:0048306 calcium-dependent protein binding
GO:0140660 cytoskeletal motor activator activity
Biological Process
GO:0010628 positive regulation of gene expression
GO:0030041 actin filament polymerization
GO:0030240 skeletal muscle thin filament assembly
GO:0048741 skeletal muscle fiber development
GO:0051017 actin filament bundle assembly
GO:0090131 mesenchyme migration
Cellular Component
GO:0001725 stress fiber
GO:0005737 cytoplasm
GO:0005856 cytoskeleton
GO:0005865 striated muscle thin filament
GO:0005884 actin filament
GO:0030027 lamellipodium
GO:0030175 filopodium
GO:0031941 filamentous actin
GO:0032432 actin filament bundle
GO:0044297 cell body
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pl8, PDBe:4pl8, PDBj:4pl8
PDBsum4pl8
PubMed25313062
UniProtP68135|ACTS_RABIT Actin, alpha skeletal muscle (Gene Name=ACTA1)

[Back to BioLiP]