Structure of PDB 4pk2 Chain A Binding Site BS01

Receptor Information
>4pk2 Chain A (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FTMEFPFDVDALFPERITVLDQHLRPPAVDLQQQIMTIIDELGKASAKAQ
NLSAPITSASRMQSNRHVVYILKDSSARPAGKGAIIGFIKVGYKKLFVLD
DREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAIDR
PSQKLLKFLNKHYNLETTVPQVNNFVIFEGFFAHQHPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pk2 Molecular basis for age-dependent microtubule acetylation by tubulin acetyltransferase.
Resolution1.35 Å
Binding residue
(original residue number in PDB)
Q58 I64 K102 L122 D123 D157 N182 F183
Binding residue
(residue number reindexed from 1)
Q50 I56 K94 L114 D115 D149 N174 F175
Enzymatic activity
Enzyme Commision number 2.3.1.108: alpha-tubulin N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0019799 tubulin N-acetyltransferase activity
Biological Process
GO:0071929 alpha-tubulin acetylation
Cellular Component
GO:0005874 microtubule

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4pk2, PDBe:4pk2, PDBj:4pk2
PDBsum4pk2
PubMed24906155
UniProtQ5SQI0|ATAT_HUMAN Alpha-tubulin N-acetyltransferase 1 (Gene Name=ATAT1)

[Back to BioLiP]