Structure of PDB 4pj0 Chain A Binding Site BS01

Receptor Information
>4pj0 Chain A (length=333) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDID
GIREPVSGSLLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGP
YQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLIY
PIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALF
CAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVAAHGYFGRLIFQ
YASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAKG
NVINTWADIINRANLGMEVMHERNAHNFPLDLA
Ligand information
>4pj0 Chain T (length=29) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
METITYVFIFACIIALFFFAIFFREPPRI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pj0 Native-like Photosystem II Superstructure at 2.44 angstrom Resolution through Detergent Extraction from the Protein Crystal.
Resolution2.437 Å
Binding residue
(original residue number in PDB)		R27 N76 I77 F239
Binding residue
(residue number reindexed from 1)		R16 N65 I66 F228
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0016682 oxidoreductase activity, acting on diphenols and related substances as donors, oxygen as acceptor
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009635 response to herbicide
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pj0, PDBe:4pj0, PDBj:4pj0
PDBsum4pj0
PubMed25438669
UniProtP0A444|PSBA1_THEVB Photosystem II protein D1 1 (Gene Name=psbA1)

[Back to BioLiP]