Structure of PDB 4pdb Chain A Binding Site BS01

Receptor Information
>4pdb Chain A (length=129) Species: 260799 (Bacillus anthracis str. Sterne) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGFIRDVEYIE
DNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGI
ALVSTSKGVMTDKDARQLQTGGEVVAYVW
Ligand information
>4pdb Chain I (length=38) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggaugcucagugauccuucgggauaucagggcauccc
<<<<<<<<<..<<<<<<....>>>..>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pdb Structure analysis of free and bound states of an RNA aptamer against ribosomal protein S8 from Bacillus anthracis.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		P29 S53 K54 Q80 R109 Y111 K113 A114 S130 T131 S132 K133 G134 G147 E149
Binding residue
(residue number reindexed from 1)		P3 S27 K28 Q54 R83 Y85 K87 A88 S104 T105 S106 K107 G108 G121 E123
Binding affinityPDBbind-CN: Kd=110nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pdb, PDBe:4pdb, PDBj:4pdb
PDBsum4pdb
PubMed25140011
UniProtQ81VR6|RS8_BACAN Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]