Structure of PDB 4pcb Chain A Binding Site BS01

Receptor Information
>4pcb Chain A (length=280) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLSHMVLTRQDIGRAASYYASEWQGKGAEELGLSGEVDSKRFRELLAGNI
GEGHRIMRSATRQDSKERIGLDLTFSAPKSVSLQALVAGDAEIIKAHDRA
VARTLEQAEARAQARQKIQGKTRIETTGNLVIGKFRHETSRERDPQLHTH
AVILNMTKRSDGQWRALKNDEIVKATRYLGAVYNAELAHELQKLGYQLRY
GKDGNFDLAHIDRQQIEGFSKRTEQIAEWYAARGLDPNSVSLEQKQAAKV
LSRAKKTSVDREALRAEWQATAKELGIDFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pcb A high security double lock and key mechanism in HUH relaxases controls oriT-processing for plasmid conjugation.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		M1 S3 H4 V6 A73 T74 R75 Q76 K79 S89 A90 P91 K92 R128 K130 Q132 G133 S153 Q159 R172 R178 A179 N182 D183 V186 R190 G193 D216 N218 S233 R235 T236 K258
Binding residue
(residue number reindexed from 1)		M1 S3 H4 V6 A60 T61 R62 Q63 K66 S76 A77 P78 K79 R115 K117 Q119 G120 S140 Q146 R159 R165 A166 N169 D170 V173 R177 G180 D203 N205 S220 R222 T223 K245
Enzymatic activity
Enzyme Commision number ?
External links