Structure of PDB 4p9z Chain A Binding Site BS01

Receptor Information
>4p9z Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGN
DVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
VPQQPTYVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p9z Protein-ligand interactions: Probing the energetics of a putative cation-pi interaction.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 S90 S96 Q106 H107 F108 K109 W121
Binding residue
(residue number reindexed from 1)
R14 R33 S35 S37 S43 Q53 H54 F55 K56 W68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4p9z, PDBe:4p9z, PDBj:4p9z
PDBsum4p9z
PubMed24856058
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]
Application loaded.