Structure of PDB 4p9u Chain A Binding Site BS01

Receptor Information
>4p9u Chain A (length=272) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSPAGFAEKYIIESIWNGRFPPGSILPAERELSELIGVTRTTLREVLQRL
ARDGWLTIQHGKPTKVNQFMETSGLHILDTLMTLDAENATSIVEDLLAAR
TNISPIFMRYAFKLNKESAERIMINVIESCEALVNAPSWDAFIAASPYAE
KIQQHVKEDSEKDELKRQEILIAKTFNFYDYMLFQRLAFHSGNQIYGLIF
NGLKKLYDRVGSYYFSNPQARELAMEFYRQLLAVCQSGEREHLPQVIRQY
GIASGHIWNQMKMTLPSNFTED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p9u The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
Resolution3.208 Å
Binding residue
(original residue number in PDB)		P8 A9 T44 T47 H65 G66
Binding residue
(residue number reindexed from 1)		P3 A4 T39 T42 H60 G61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000062 fatty-acyl-CoA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006631 fatty acid metabolic process
GO:0019217 regulation of fatty acid metabolic process
GO:0071072 negative regulation of phospholipid biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4p9u, PDBe:4p9u, PDBj:4p9u
PDBsum4p9u
PubMed25607896
UniProtQ9KQU8|FADR_VIBCH Fatty acid metabolism regulator protein (Gene Name=fadR)

[Back to BioLiP]