Structure of PDB 4p4p Chain A Binding Site BS01

Receptor Information

>4p4p Chain A (length=282) Species: 5671 (Leishmania infantum)

KYKVPKLKAIQELTQVHGFGPRAAAALFDREGIFTVDELLQKADSIPSLT
DQQRVGIKYFYDINEKIPMQESVLHENYLREKCMEVLGKDFSILICGSYR
RRHPFSGDVDAILSRTLDAPPLSEPVAATGVLGHFVEFLESLKYLEATMA
QGPLKYMGMGRLPPRINTKVYKARRVDIRLIETKSVPTAMLTFTGSKNFN
VIMRQAAISKGYLLNEYGLFKLGTPEEARALYERIGIRGKNAGEELGVPK
DELEDKRVEVRSEQDVFDVLGMPYAKPENRDP

Ligand information

>4p4p Chain C (length=7)

cagtact

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4p4p Structures of the Leishmania infantum polymerase beta.
• Resolution: 2.2973 Å
• Binding residue (original residue number in PDB): H103 G104 F105 G106 P107 R108 A109 D194 R269 D271 R273 T286 F287 T288 G289 K291 N294
• Binding residue (residue number reindexed from 1): H17 G18 F19 G20 P21 R22 A23 D108 R175 D177 R179 T192 F193 T194 G195 K197 N200

Enzymatic activity

• Catalytic site (original residue number in PDB): D271
• Catalytic site (residue number reindexed from 1): D177
• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0016772 transferase activity, transferring phosphorus-containing groups
• GO:0034061 DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006259 DNA metabolic process
• GO:0006281 DNA repair
• GO:0006303 double-strand break repair via nonhomologous end joining
• GO:0071897 DNA biosynthetic process

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4p4p, PDBe:4p4p, PDBj:4p4p
• PDBsum: 4p4p
• PubMed: 24666693
• UniProt: Q9U6N3