Structure of PDB 4p3d Chain A Binding Site BS01

Receptor Information
>4p3d Chain A (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVKLVESGGGLVKPGGSLKLSCAASGFIFSNYAMSWVRQTPEKRLEWVAT
ISGGGRNIYSLDSVKGRFTFFRDNARNTLYLQMSSLRSEDTAMYFCSREN
YGSSFTYWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGY
FPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTC
NVAHPASSTKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p3d Inhibition mechanism of membrane metalloprotease by an exosite-swiveling conformational antibody.
Resolution1.949 Å
Binding residue
(original residue number in PDB)
N31 T50 S52 G53 N57 Y59 E99 N100 Y101 G102 S103 S104
Binding residue
(residue number reindexed from 1)
N31 T50 S52 G53 N57 Y59 E99 N100 Y101 G102 S103 S104
External links