Structure of PDB 4p2o Chain A Binding Site BS01

Receptor Information
>4p2o Chain A (length=175) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAK
FASFEAQGALANIAVDKANLDVMKERSANVAPEVTVLSRSPVNLGEPNIL
ICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLP
STDDFYDCEVDHWGLEEPLRKHWEF
Ligand information
>4p2o Chain P (length=20) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PADPLAFFSSAIKGGGGSLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p2o Deconstructing the Peptide-MHC Specificity of T Cell Recognition.
Resolution2.603 Å
Binding residue
(original residue number in PDB)		Q9 F51 A52 S53 F54 G58 N62 V65 N69 V72 R76
Binding residue
(residue number reindexed from 1)		Q9 F51 A52 S53 F54 G58 N62 V65 N69 V72 R76
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4p2o, PDBe:4p2o, PDBj:4p2o
PDBsum4p2o
PubMed24855945
UniProtP04224|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]