Structure of PDB 4p0q Chain A Binding Site BS01

Receptor Information
>4p0q Chain A (length=285) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQQPLELRPGEYRVLLCVDIGETRGHRPELLRELQRLHVTHTVRKLHVGD
FVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLK
RCGLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKE
SAAYLALLTRGLQRLYQGHTLRSRPWGTPGPNPLCSLLTFSDFNAGAIKN
KAQSVREVFARQLMQVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQ
ETLLSTIKCGRLQRNLGPALSRTLSQLYCSYGPLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4p0q Crystal structures of the structure-selective nuclease Mus81-Eme1 bound to flap DNA substrates.
Resolution2.851 Å
Binding residue
(original residue number in PDB)		I344 F349 R350 T383 Q386 A387 N390 N531 P534 A535
Binding residue
(residue number reindexed from 1)		I87 F92 R93 T126 Q129 A130 N133 N265 P268 A269
Enzymatic activity
Enzyme Commision number 3.1.22.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004518 nuclease activity
GO:0008821 crossover junction DNA endonuclease activity
Biological Process
GO:0006302 double-strand break repair
GO:0006308 DNA catabolic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4p0q, PDBe:4p0q, PDBj:4p0q
PDBsum4p0q
PubMed24733841
UniProtQ96NY9|MUS81_HUMAN Crossover junction endonuclease MUS81 (Gene Name=MUS81)

[Back to BioLiP]