Structure of PDB 4oz6 Chain A Binding Site BS01

Receptor Information
>4oz6 Chain A (length=172) Species: 1789 (Mycobacterium xenopi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRL
FHSGEHPVYTVRTVEGLRVTGTANHPLLCLVDVAGVPTLLWKLIDEIKPG
DYAVIQRSAFVPGLVRFLAQAIADELTDGRFYYAKVASVTDAGVQPVYSL
RVDACDPAFITNGFVSHNTEAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oz6 Structure of the branched intermediate in protein splicing.
Resolution2.786 Å
Binding residue
(original residue number in PDB)		T199 E200 A201
Binding residue
(residue number reindexed from 1)		T169 E170 A171
Enzymatic activity
Catalytic site (original residue number in PDB) A1 T72 N74 H75 H197 N198
Catalytic site (residue number reindexed from 1) A1 T72 N74 H75 H167 N168
Enzyme Commision number 5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).
Gene Ontology
Biological Process
GO:0016539 intein-mediated protein splicing

View graph for
Biological Process
External links
PDB RCSB:4oz6, PDBe:4oz6, PDBj:4oz6
PDBsum4oz6
PubMed24778214
UniProtP72065|GYRA_MYCXE DNA gyrase subunit A (Fragment) (Gene Name=gyrA)

[Back to BioLiP]