Structure of PDB 4oyk Chain A Binding Site BS01

Receptor Information
>4oyk Chain A (length=173) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARL
VRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFR
STVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLL
RTELSLLLQNTHPRQQALEQLLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oyk Molecular Basis and Regulation of OTULIN-LUBAC Interaction.
Resolution2.0001 Å
Binding residue
(original residue number in PDB)		K81 Y82 N85 P92 Y94 G97 V98 K99 N101 N102 P103 V104
Binding residue
(residue number reindexed from 1)		K75 Y76 N79 P86 Y88 G91 V92 K93 N95 N96 P97 V98
Enzymatic activity
Enzyme Commision number 2.3.2.31: RBR-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
Cellular Component
GO:0071797 LUBAC complex

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4oyk, PDBe:4oyk, PDBj:4oyk
PDBsum4oyk
PubMed24726323
UniProtQ96EP0|RNF31_HUMAN E3 ubiquitin-protein ligase RNF31 (Gene Name=RNF31)

[Back to BioLiP]