Structure of PDB 4oxd Chain A Binding Site BS01

Receptor Information
>4oxd Chain A (length=185) Species: 171101 (Streptococcus pneumoniae R6) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEVVNKGDYYSIQGKYDEIIVANKHYPLSKDYNPGENPTAKAELVKLI
KAMQEAGFPISDHYSGFRSYETQTKLYQDYVNQDGKEAADRYSARPGYSE
HQTGLAFDVIGTDGDLVTEEKAAQWLLDHAADYGFVVRYLKGKEKETGYM
AEEWHLRYVGKEAKEIAESGLSLEEYYGFEGGDYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oxd Structure of the LdcB LD-carboxypeptidase reveals the molecular basis of peptidoglycan recognition.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R120 Q125 Y144 S145 A146 S151 H153 D160 Y191 Y201 E204 H207
Binding residue
(residue number reindexed from 1)		R68 Q73 Y92 S93 A94 S99 H101 D108 Y139 Y149 E152 H155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4oxd, PDBe:4oxd, PDBj:4oxd
PDBsum4oxd
PubMed24909784
UniProtQ8DQQ1

[Back to BioLiP]