Structure of PDB 4opj Chain A Binding Site BS01

Receptor Information
>4opj Chain A (length=133) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFL
AIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKL
VDEAEEWLNTHTYETPILKWQTDKWGEIKADYG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4opj Generating Crystallographic Models of DNA Dodecamers from Structures of RNase H:DNA Complexes.
Resolution1.541 Å
Binding residue
(original residue number in PDB)		N77 T104 N106 T135 W139 S147 T148
Binding residue
(residue number reindexed from 1)		N16 T43 N45 T74 W78 S86 T87
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:4opj, PDBe:4opj, PDBj:4opj
PDBsum4opj
PubMed26227040
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]