Structure of PDB 4ogq Chain A Binding Site BS01

Receptor Information

>4ogq Chain A (length=214) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

ANVYDWFEERLEIQAIAEDVTSKYVPPHVNIFYCLGGITLVCFLIQFATG
FAMTFYYKPTVAEAYSSVQYIMNEVNFGWLIRSIHRWSASMMVLMMILHV
FRVYLTGGFKKPRELTWVSGVILAVITVSFGVTGYSLPWDQVGYWAVKIV
SGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLF
HFLMIRKQGISGPL

Ligand information

>4ogq Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418)

MAILTLGWVSLLVVFTWSIAMVVWGRNGL

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4ogq Internal Lipid Architecture of the Hetero-Oligomeric Cytochrome b6f Complex.
• Resolution: 2.501 Å
• Binding residue (original residue number in PDB): N31 I32
• Binding residue (residue number reindexed from 1): N30 I31

Enzymatic activity

• Catalytic site (original residue number in PDB): R207 I211
• Catalytic site (residue number reindexed from 1): R206 I210

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0045158 electron transporter, transferring electrons within cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4ogq, PDBe:4ogq, PDBj:4ogq
• PDBsum: 4ogq
• PubMed: 24931468
• UniProt: P0A384|CYB6_NOSS1 Cytochrome b6 (Gene Name=petB)