Structure of PDB 4ofa Chain A Binding Site BS01

Receptor Information
>4ofa Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYPS
AEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGI
GKYGNDSYRIFCVNEWKQVHPENHKLNKYHDWLWENHEKLSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ofa Structure of MBD4 bound to G:T mispair DNA
Resolution1.55 Å
Binding residue
(original residue number in PDB)		L447 Q449 L466 N467 R468 S470 G536 I537 G538 Y540 G541 N560 K562
Binding residue
(residue number reindexed from 1)		L10 Q12 L29 N30 R31 S33 G99 I100 G101 Y103 G104 N123 K125
Enzymatic activity
Enzyme Commision number 3.2.2.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003824 catalytic activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ofa, PDBe:4ofa, PDBj:4ofa
PDBsum4ofa
PubMed
UniProtO95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 (Gene Name=MBD4)

[Back to BioLiP]