Structure of PDB 4odp Chain A Binding Site BS01

Receptor Information
>4odp Chain A (length=101) Species: 9606,300852 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAIPPHATLDFQVEVVKVREATPEELLHGHAHPSGHHHHH
H
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4odp Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
Resolution1.747 Å
Binding residue
(original residue number in PDB)		R34 N35 L36 I37
Binding residue
(residue number reindexed from 1)		R34 N35 L36 I37
Enzymatic activity
Catalytic site (original residue number in PDB) Y13 L22 D23 I37 F80
Catalytic site (residue number reindexed from 1) Y13 L22 D23 I37 F71
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity

View graph for
Molecular Function
External links
PDB RCSB:4odp, PDBe:4odp, PDBj:4odp
PDBsum4odp
PubMed27664121
UniProtP62942|FKB1A_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP1A (Gene Name=FKBP1A);
Q5SLE7

[Back to BioLiP]