Structure of PDB 4odk Chain A Binding Site BS01

Receptor Information

>4odk Chain A (length=153) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEG
EAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDNPMPL
TVVAVEGEEVTVDFNHPLAGKDLDFQVEVVKVREATPEELLHGHAHPSGH
HHH

Ligand information

>4odk Chain B (length=8) Species: 5062 (Aspergillus oryzae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HKYNNYEG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4odk Molecular insights into substrate recognition and catalytic mechanism of the chaperone and FKBP peptidyl-prolyl isomerase SlyD.
Resolution	1.401 Å
Binding residue (original residue number in PDB)	A78 P80 F91 Y92 A93 Q94 L103
Binding residue (residue number reindexed from 1)	A78 P80 F91 Y92 A93 Q94 L100

Enzymatic activity

Enzyme Commision number

5.2.1.8: peptidylprolyl isomerase.

Gene Ontology

	Molecular Function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0042026	protein refolding

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4odk, PDBe:4odk, PDBj:4odk
PDBsum	4odk
PubMed	27664121
UniProt	Q5SLE7

[Back to BioLiP]