Structure of PDB 4oaj Chain A Binding Site BS01

Receptor Information
>4oaj Chain A (length=92) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGK
LQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4oaj Crystal structure of the complex between SAP97 PDZ2 and 5HT2A receptor peptide
Resolution2.3 Å
Binding residue
(original residue number in PDB)
L329 G330 F331 S332 I333 A334 N339 H341 H384 V388
Binding residue
(residue number reindexed from 1)
L15 G16 F17 S18 I19 A20 N25 H27 H70 V74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4oaj, PDBe:4oaj, PDBj:4oaj
PDBsum4oaj
PubMed
UniProtQ811D0|DLG1_MOUSE Disks large homolog 1 (Gene Name=Dlg1)

[Back to BioLiP]