Structure of PDB 4o3u Chain A Binding Site BS01

Receptor Information
>4o3u Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDV
HGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYG
STIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLN
ESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRP
GIFVRVAYYAKWIHKIILT
Ligand information
>4o3u Chain P (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IIGGCPYWMDREEC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4o3u An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		H551 S611 V614 Y619 T620 L629 R630 V631 H633 L634 S666 G667 C669 D672
Binding residue
(residue number reindexed from 1)		H48 S108 V111 Y116 T117 L126 R127 V128 H130 L131 S163 G164 C166 D169
Enzymatic activity
Catalytic site (original residue number in PDB) Q534 D578 E670 G671 D672 Y673 G674
Catalytic site (residue number reindexed from 1) Q31 D75 E167 G168 D169 Y170 G171
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4o3u, PDBe:4o3u, PDBj:4o3u
PDBsum4o3u
PubMed24859116
UniProtP14210|HGF_HUMAN Hepatocyte growth factor (Gene Name=HGF)

[Back to BioLiP]