Structure of PDB 4o3t Chain A Binding Site BS01

Receptor Information
>4o3t Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDV
HGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYG
STIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLN
ESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRP
GIFVRVAYYAKWIHKIILT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4o3t An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		I505 H551 G616 Y619 T620 L629 R630 V631 H633 S666 G667 D672 A698
Binding residue
(residue number reindexed from 1)		I2 H48 G113 Y116 T117 L126 R127 V128 H130 S163 G164 D169 A195
Enzymatic activity
Catalytic site (original residue number in PDB) Q534 D578 E670 G671 D672 Y673 G674
Catalytic site (residue number reindexed from 1) Q31 D75 E167 G168 D169 Y170 G171
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4o3t, PDBe:4o3t, PDBj:4o3t
PDBsum4o3t
PubMed24859116
UniProtP14210|HGF_HUMAN Hepatocyte growth factor (Gene Name=HGF)

[Back to BioLiP]