Structure of PDB 4nxq Chain A Binding Site BS01

Receptor Information
>4nxq Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKG
LKAGDEILEINNRAADALNSSMMEDFFSQPSVGLLVRTYPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nxq Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		T857 Y858 F860 S861 L862 S864 V865 N876 S908 M911 E912 F915
Binding residue
(residue number reindexed from 1)		T19 Y20 F22 S23 L24 S26 V27 N38 S70 M73 E74 F77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005085 guanyl-nucleotide exchange factor activity
Biological Process
GO:0007264 small GTPase-mediated signal transduction
GO:0090630 activation of GTPase activity

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4nxq, PDBe:4nxq, PDBj:4nxq
PDBsum4nxq
PubMed27998539
UniProtQ13009|TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 (Gene Name=TIAM1)

[Back to BioLiP]