Structure of PDB 4nw3 Chain A Binding Site BS01

Receptor Information
>4nw3 Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQW
M
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nw3 DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution2.82 Å
Binding residue
(original residue number in PDB)		S1152 R1154 K1186 Q1187 C1188 K1193
Binding residue
(residue number reindexed from 1)		S3 R5 K37 Q38 C39 K44
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:4nw3, PDBe:4nw3, PDBj:4nw3
PDBsum4nw3
PubMed29276034
UniProtQ03164|KMT2A_HUMAN Histone-lysine N-methyltransferase 2A (Gene Name=KMT2A)

[Back to BioLiP]