Structure of PDB 4nut Chain A Binding Site BS01

Receptor Information
>4nut Chain A (length=122) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PNPKAFPLADAALTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFII
MAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASIT
TNDASAIKTQIYAVKDKIETLL
Ligand information
>4nut Chain B (length=27) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEDVKKWREERKKMWLLKISNNKQKHM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nut Proteomic and 3D structure analyses highlight the C/D box snoRNP assembly mechanism and its control
Resolution1.55 Å
Binding residue
(original residue number in PDB)		P6 K7 F9 L69 E72 N75 V76 P77 Y78 Y115 K118 D119 I121 E122 L125
Binding residue
(residue number reindexed from 1)		P3 K4 F6 L66 E69 N72 V73 P74 Y75 Y112 K115 D116 I118 E119 L122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0034511 U3 snoRNA binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000452 snoRNA guided rRNA 2'-O-methylation
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000494 box C/D sno(s)RNA 3'-end processing
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0030490 maturation of SSU-rRNA
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005687 U4 snRNP
GO:0005730 nucleolus
GO:0031428 box C/D methylation guide snoRNP complex
GO:0032040 small-subunit processome
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071001 U4/U6 snRNP
GO:0071011 precatalytic spliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4nut, PDBe:4nut, PDBj:4nut
PDBsum4nut
PubMed25404746
UniProtP39990|SNU13_YEAST 13 kDa ribonucleoprotein-associated protein (Gene Name=SNU13)

[Back to BioLiP]