Structure of PDB 4nod Chain A Binding Site BS01

Receptor Information
>4nod Chain A (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPD
SKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAM
TKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLS
DSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nod Distinct structural features of TFAM drive mitochondrial DNA packaging versus transcriptional activation.
Resolution2.897 Å
Binding residue
(original residue number in PDB)
L58 L65 T77 R140 M143 K146 Y162 Q179 K186 W189
Binding residue
(residue number reindexed from 1)
L15 L22 T34 R97 M100 K103 Y119 Q136 K143 W146
Binding affinityPDBbind-CN: Kd=7.1nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4nod, PDBe:4nod, PDBj:4nod
PDBsum4nod
PubMed24435062
UniProtQ00059|TFAM_HUMAN Transcription factor A, mitochondrial (Gene Name=TFAM)

[Back to BioLiP]