Structure of PDB 4ni7 Chain A Binding Site BS01

Receptor Information
>4ni7 Chain A (length=151) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQPLTSSERIDKQIRYILDGISALRKETCNKSNLNLPKMAEKDGCFQSGF
NEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQK
KAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQ
M
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ni7 Crystal structure of interleukin-6 in complex with a modified nucleic Acid ligand.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R16 R24 K27 Q28 R30 Y31 L33 M117 S118 V121 F125 K171 Q175 L178
Binding residue
(residue number reindexed from 1)		R1 R9 K12 Q13 R15 Y16 L18 M89 S90 V93 F97 K138 Q142 L145
Binding affinityPDBbind-CN: Kd=0.2nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005125 cytokine activity
GO:0005138 interleukin-6 receptor binding
Biological Process
GO:0006955 immune response
GO:0030154 cell differentiation
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ni7, PDBe:4ni7, PDBj:4ni7
PDBsum4ni7
PubMed24415767
UniProtP05231|IL6_HUMAN Interleukin-6 (Gene Name=IL6)

[Back to BioLiP]