Structure of PDB 4nhj Chain A Binding Site BS01

Receptor Information
>4nhj Chain A (length=102) Species: 573 (Klebsiella pneumoniae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRD
ALLKNLRGVTYDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFA
PH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nhj Structural dynamics of the two-component response regulator RstA in recognition of promoter DNA element.
Resolution2.701 Å
Binding residue
(original residue number in PDB)		S162 R190 V203 R207 R226
Binding residue
(residue number reindexed from 1)		S29 R57 V70 R74 R93
Binding affinityPDBbind-CN: Kd=5.15uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4nhj, PDBe:4nhj, PDBj:4nhj
PDBsum4nhj
PubMed24990372
UniProtA6T8N1

[Back to BioLiP]