Structure of PDB 4nb3 Chain A Binding Site BS01

Receptor Information
>4nb3 Chain A (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMS
DGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILM
ELEVLKSAEAVGVKIGNPVPYNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4nb3 Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A.
Resolution1.35 Å
Binding residue
(original residue number in PDB)		T35 R41 R43 S55 F56 M57 T60 I83 N85 L87 K88 R91
Binding residue
(residue number reindexed from 1)		T38 R44 R46 S58 F59 M60 T63 I86 N88 L90 K91 R94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006260 DNA replication
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4nb3, PDBe:4nb3, PDBj:4nb3
PDBsum4nb3
PubMed24491171
UniProtP27694|RFA1_HUMAN Replication protein A 70 kDa DNA-binding subunit (Gene Name=RPA1)

[Back to BioLiP]