Structure of PDB 4naw Chain A Binding Site BS01

Receptor Information
>4naw Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFI
YVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4naw Structural basis of ATG3 recognition by the autophagic ubiquitin-like protein ATG12.
Resolution2.195 Å
Binding residue
(original residue number in PDB)		K54 K72 W73 A74 V75 R79 F87
Binding residue
(residue number reindexed from 1)		K2 K20 W21 A22 V23 R27 F35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000045 autophagosome assembly
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4naw, PDBe:4naw, PDBj:4naw
PDBsum4naw
PubMed24191030
UniProtO94817|ATG12_HUMAN Ubiquitin-like protein ATG12 (Gene Name=ATG12)

[Back to BioLiP]