Structure of PDB 4n7h Chain A Binding Site BS01

Receptor Information
>4n7h Chain A (length=33) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n7h Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).
Resolution1.698 Å
Binding residue
(original residue number in PDB)		R430 A432 F438 I440 H442 K445 T447 W449
Binding residue
(residue number reindexed from 1)		R10 A12 F18 I20 H22 K25 T27 W29
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
External links
PDB RCSB:4n7h, PDBe:4n7h, PDBj:4n7h
PDBsum4n7h
PubMed24379409
UniProtP46934|NEDD4_HUMAN E3 ubiquitin-protein ligase NEDD4 (Gene Name=NEDD4)

[Back to BioLiP]