Structure of PDB 4n5t Chain A Binding Site BS01

Receptor Information
>4n5t Chain A (length=90) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPGEGTQVHPRAPLLQILKVAGAQEEVFTVKEVMHYLGQYIMMKQLYDKQ
RQHIVHCHDDPLGELLEVGSFSVKNPSPLYEMLKRNLVIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n5t Stapled alpha-helical peptide drug development: a potent dual inhibitor of MDM2 and MDMX for p53-dependent cancer therapy.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		M50 G54 I57 M58 Y63 Q68 H69 V89 L95 Y96
Binding residue
(residue number reindexed from 1)		M34 G38 I41 M42 Y47 Q52 H53 V73 L79 Y80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4n5t, PDBe:4n5t, PDBj:4n5t
PDBsum4n5t
PubMed23946421
UniProtQ7ZUW7|MDM4_DANRE Protein Mdm4 (Gene Name=mdm4)

[Back to BioLiP]