Structure of PDB 4n4f Chain A Binding Site BS01

Receptor Information
>4n4f Chain A (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVK
NPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSK
LAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCNVTLGDDPSQPQTTKKK
NDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n4f Structural Insights into Acetylated-Histone H4 Recognition by the Bromodomain-PHD Finger Module of Human Transcriptional Coactivator CBP.
Resolution1.83 Å
Binding residue
(original residue number in PDB)		V1115 I1122 D1124 L1166 Y1167 N1168 R1169
Binding residue
(residue number reindexed from 1)		V35 I42 D44 L86 Y87 N88 R89
Enzymatic activity
Enzyme Commision number 2.3.1.-
2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4n4f, PDBe:4n4f, PDBj:4n4f
PDBsum4n4f
PubMed24361270
UniProtQ92793|CBP_HUMAN CREB-binding protein (Gene Name=CREBBP)

[Back to BioLiP]