Structure of PDB 4n2s Chain A Binding Site BS01

Receptor Information
>4n2s Chain A (length=197) Species: 15368 (Brachypodium distachyon) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQ
RQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALV
EAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEA
AVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARHLPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4n2s Structural basis for RNA recognition by a dimeric PPR-protein complex.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y169 T172 R173 R176 D203 Y205
Binding residue
(residue number reindexed from 1)		Y126 T129 R130 R133 D160 Y162
Binding affinityPDBbind-CN: IC50=0.25uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0042802 identical protein binding
Biological Process
GO:0000373 Group II intron splicing
GO:0009658 chloroplast organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4n2s, PDBe:4n2s, PDBj:4n2s
PDBsum4n2s
PubMed24186060
UniProtI1HB13

[Back to BioLiP]