Structure of PDB 4mzh Chain A Binding Site BS01

Receptor Information
>4mzh Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSHHHHHHGSRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLI
KYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEH
MFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGD
LRIMSLVGKQVEYAKGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mzh Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1
Resolution2.204 Å
Binding residue
(original residue number in PDB)		G93 D95 M140 F141 E142 W151 Y170 D173 Y177 Y179 D184 D189
Binding residue
(residue number reindexed from 1)		G54 D56 M101 F102 E103 W112 Y131 D134 Y138 Y140 D145 D150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007276 gamete generation

View graph for
Biological Process
External links
PDB RCSB:4mzh, PDBe:4mzh, PDBj:4mzh
PDBsum4mzh
PubMed24589551
UniProtQ9Y657|SPIN1_HUMAN Spindlin-1 (Gene Name=SPIN1)

[Back to BioLiP]