Structure of PDB 4my2 Chain A Binding Site BS01

Receptor Information
>4my2 Chain A (length=474) Species: 9606,83333 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVA
ATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNG
KLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNL
QEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKN
KHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFK
GQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGA
VALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAA
SGRQTVDEALKDAQTNAAAEFIMDSDPRRCMRHHYVDSISHPLYKCSSKM
VLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLR
CSGGMRLTATYRYILSCHCEECNS
Ligand information
Ligand IDGLC
InChIInChI=1S/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6+/m1/s1
InChIKeyWQZGKKKJIJFFOK-DVKNGEFBSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0C(C1C(C(C(C(O1)O)O)O)O)O
OpenEye OEToolkits 1.5.0C([C@@H]1[C@H]([C@@H]([C@H]([C@H](O1)O)O)O)O)O
CACTVS 3.341OC[CH]1O[CH](O)[CH](O)[CH](O)[CH]1O
CACTVS 3.341OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@@H]1O
ACDLabs 10.04OC1C(O)C(OC(O)C1O)CO
FormulaC6 H12 O6
Namealpha-D-glucopyranose;
alpha-D-glucose;
D-glucose;
glucose
ChEMBLCHEMBL423707
DrugBank
ZINCZINC000003861213
PDB chain4my2 Chain B Residue 1 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4my2 Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D16 K17 E113 Y157 W232
Binding residue
(residue number reindexed from 1)		D13 K14 E110 Y154 W229
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005109 frizzled binding
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0000320 re-entry into mitotic cell cycle
GO:0001508 action potential
GO:0001525 angiogenesis
GO:0001666 response to hypoxia
GO:0001890 placenta development
GO:0001974 blood vessel remodeling
GO:0002088 lens development in camera-type eye
GO:0003406 retinal pigment epithelium development
GO:0003407 neural retina development
GO:0006099 tricarboxylic acid cycle
GO:0006366 transcription by RNA polymerase II
GO:0006544 glycine metabolic process
GO:0006622 protein targeting to lysosome
GO:0006749 glutathione metabolic process
GO:0006954 inflammatory response
GO:0007033 vacuole organization
GO:0007179 transforming growth factor beta receptor signaling pathway
GO:0007224 smoothened signaling pathway
GO:0007399 nervous system development
GO:0007601 visual perception
GO:0008104 protein localization
GO:0008283 cell population proliferation
GO:0008643 carbohydrate transport
GO:0009069 serine family amino acid metabolic process
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0014004 microglia differentiation
GO:0016055 Wnt signaling pathway
GO:0016358 dendrite development
GO:0016567 protein ubiquitination
GO:0021554 optic nerve development
GO:0030182 neuron differentiation
GO:0031290 retinal ganglion cell axon guidance
GO:0035426 extracellular matrix-cell signaling
GO:0035640 exploration behavior
GO:0045446 endothelial cell differentiation
GO:0045893 positive regulation of DNA-templated transcription
GO:0046697 decidualization
GO:0048678 response to axon injury
GO:0051091 positive regulation of DNA-binding transcription factor activity
GO:0051402 neuron apoptotic process
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0055085 transmembrane transport
GO:0060041 retina development in camera-type eye
GO:0060042 retina morphogenesis in camera-type eye
GO:0060070 canonical Wnt signaling pathway
GO:0060221 retinal rod cell differentiation
GO:0060856 establishment of blood-brain barrier
GO:0060996 dendritic spine development
GO:0061298 retina vasculature development in camera-type eye
GO:0061299 retina vasculature morphogenesis in camera-type eye
GO:0061304 retinal blood vessel morphogenesis
GO:0061518 microglial cell proliferation
GO:0070086 ubiquitin-dependent endocytosis
GO:0071456 cellular response to hypoxia
GO:0097601 retina blood vessel maintenance
GO:0110135 Norrin signaling pathway
GO:1904390 cone retinal bipolar cell differentiation
GO:1990963 establishment of blood-retinal barrier
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0009986 cell surface
GO:0062023 collagen-containing extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4my2, PDBe:4my2, PDBj:4my2
PDBsum4my2
PubMed24186977
UniProtP0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE);
Q00604|NDP_HUMAN Norrin (Gene Name=NDP)

[Back to BioLiP]