Structure of PDB 4mxq Chain A Binding Site BS01

Receptor Information
>4mxq Chain A (length=174) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPW
MEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGC
DVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAG
AAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mxq Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
Resolution2.596 Å
Binding residue
(original residue number in PDB)
Y7 Y45 G69 Q70 W73 N77 L81 Y84 W97 Y99 T143 W147 Y155 Y156 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)
Y6 Y44 G68 Q69 W72 N76 L80 Y83 W96 Y98 T142 W146 Y154 Y155 Y158 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4mxq, PDBe:4mxq, PDBj:4mxq
PDBsum4mxq
PubMed26523866
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]