Structure of PDB 4mvk Chain A Binding Site BS01

Receptor Information

>4mvk Chain A (length=171) Species: 9606 (Homo sapiens)

LIPAPPLSKVPLQQNFQDNQFHGKWYVVGVAGNKSLREDKDPWKMYATIY
ELKEDKSYNVTSVGFGTKKCHYKIRTFVPGSQPGEFTLGRIKSRPGRTSA
LVRVVSTNYNQHAMVFFKVVQQNRESFNITLYGRTKELTSELKENFIRFS
KSLGLPENHIVFPVPIDQCID

Ligand information

>4mvk Chain B (length=6) Species: 9606 (Homo sapiens)

VFFAED

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4mvk High-affinity Anticalins with aggregation-blocking activity directed against the Alzheimer beta-amyloid peptide.
• Resolution: 1.5 Å
• Binding residue (original residue number in PDB): W49 K50 Y52 T54 S68 G70 H77 K79 R81 F83 F123 V125 N134 T136 Y138 P169
• Binding residue (residue number reindexed from 1): W43 K44 Y46 T48 S62 G64 H71 K73 R75 F77 F117 V119 N128 T130 Y132 P163

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0036094 small molecule binding
• GO:0042802 identical protein binding
• GO:0140315 iron ion sequestering activity
• GO:1903981 enterobactin binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006915 apoptotic process
• GO:0015891 siderophore transport
• GO:0042742 defense response to bacterium
• GO:0045087 innate immune response
• GO:0120162 positive regulation of cold-induced thermogenesis

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0031410 cytoplasmic vesicle
• GO:0035580 specific granule lumen
• GO:0060205 cytoplasmic vesicle lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4mvk, PDBe:4mvk, PDBj:4mvk
• PDBsum: 4mvk
• PubMed: 27029347
• UniProt: P80188|NGAL_HUMAN Neutrophil gelatinase-associated lipocalin (Gene Name=LCN2)