Structure of PDB 4mvb Chain A Binding Site BS01

Receptor Information
>4mvb Chain A (length=174) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPW
MEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGC
DVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAG
AAEYYRAYLEGECVEWLHRYLKNG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mvb Structural interplay between germline interactions and adaptive recognition determines the bandwidth of TCR-peptide-MHC cross-reactivity.
Resolution3.088 Å
Binding residue
(original residue number in PDB)
Q70 W73 N77 Y84 W97 Y99 Y123 W147 A152 Y155 Y156 Y159 W167
Binding residue
(residue number reindexed from 1)
Q69 W72 N76 Y83 W96 Y98 Y122 W146 A151 Y154 Y155 Y158 W166
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:4mvb, PDBe:4mvb, PDBj:4mvb
PDBsum4mvb
PubMed26523866
UniProtP01897|HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain (Gene Name=H2-L)

[Back to BioLiP]