Structure of PDB 4mtd Chain A Binding Site BS01

Receptor Information
>4mtd Chain A (length=149) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLRE
AEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFIC
DRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEAC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mtd Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Y45 P61 Y64 K78 Y85
Binding residue
(residue number reindexed from 1)		Y42 P58 Y61 K75 Y82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mtd, PDBe:4mtd, PDBj:4mtd
PDBsum4mtd
PubMed25369000
UniProtP0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)

[Back to BioLiP]