Structure of PDB 4mn3 Chain A Binding Site BS01

Receptor Information
>4mn3 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMA
YEEKEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mn3 Chromodomain Antagonists That Target the Polycomb-Group Methyllysine Reader Protein Chromobox Homolog 7 (CBX7).
Resolution1.542 Å
Binding residue
(original residue number in PDB)		E2 Q3 V4 F5 A6 V7 W26 W29 Y33 E37 H41 L43 D44
Binding residue
(residue number reindexed from 1)		E2 Q3 V4 F5 A6 V7 W26 W29 Y33 E37 H41 L43 D44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:4mn3, PDBe:4mn3, PDBj:4mn3
PDBsum4mn3
PubMed24625057
UniProtO95931|CBX7_HUMAN Chromobox protein homolog 7 (Gene Name=CBX7)

[Back to BioLiP]