Structure of PDB 4mml Chain A Binding Site BS01

Receptor Information

>4mml Chain A (length=67) Species: 208964 (Pseudomonas aeruginosa PAO1)

GHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFAQFVILLKNTVSQM
VYKHAISTVVPSRPVRL

Ligand information

• Ligand ID: U
• InChI: InChI=1S/C9H13N2O9P/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(20-8)3-19-21(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1
• InChIKey: DJJCXFVJDGTHFX-XVFCMESISA-N
• SMILES:
  ACDLabs 10.04: O=C1NC(=O)N(C=C1)C2OC(C(O)C2O)COP(=O)(O)O
  CACTVS 3.341: O[CH]1[CH](O)[CH](O[CH]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O
  OpenEye OEToolkits 1.5.0: C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O)O)O)O
  OpenEye OEToolkits 1.5.0: C1=CN(C(=O)NC1=O)C2C(C(C(O2)COP(=O)(O)O)O)O
  CACTVS 3.341: O[C@H]1[C@@H](O)[C@@H](O[C@@H]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O
• Formula: C9 H13 N2 O9 P
• Name: URIDINE-5'-MONOPHOSPHATE
• ChEMBL: CHEMBL214393
• DrugBank: DB03685
• ZINC: ZINC000002123545
• PDB chain: 4mml Chain A Residue 103

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4mml Effect of conserved intersubunit amino Acid substitutions on hfq protein structure and stability.
• Resolution: 1.801 Å
• Binding residue (original residue number in PDB): Q8 Q41 F42
• Binding residue (residue number reindexed from 1): Q5 Q38 F39
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006417 regulation of translation
• GO:0009372 quorum sensing
• GO:0043487 regulation of RNA stability
• GO:0043609 regulation of carbon utilization
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4mml, PDBe:4mml, PDBj:4mml
• PDBsum: 4mml
• PubMed: 24954598
• UniProt: Q9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)