Structure of PDB 4mls Chain A Binding Site BS01

Receptor Information
>4mls Chain A (length=81) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGK
YTFVETAAPDGYEVATAITFTVNEQGQVTVN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mls Structural Analysis and Optimization of the Covalent Association between SpyCatcher and a Peptide Tag.
Resolution1.984 Å
Binding residue
(original residue number in PDB)		I27 K28 F29 S30 K31 R32 E34 D35 L39 M44 F75 E77 G83 Y84 E85 A87 I90 V100
Binding residue
(residue number reindexed from 1)		I5 K6 F7 S8 K9 R10 E12 D13 L17 M22 F53 E55 G61 Y62 E63 A65 I68 V78
Enzymatic activity
Enzyme Commision number ?
External links