Structure of PDB 4mi8 Chain A Binding Site BS01

Receptor Information
>4mi8 Chain A (length=135) Species: 33708 (Murid gammaherpesvirus 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRH
YDSVYRADYGPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEE
VLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLED
Ligand information
>4mi8 Chain C (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TMENLSRRLKVTEALFDIMS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mi8 Targeting gamma-herpesvirus 68 Bcl-2-mediated down-regulation of autophagy.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		F48 Y52 Y56 Y60 P62 A63 L74 S77 D81 N84 G86 R87
Binding residue
(residue number reindexed from 1)		F47 Y51 Y55 Y59 P61 A62 L73 S76 D80 N83 G85 R86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:4mi8, PDBe:4mi8, PDBj:4mi8
PDBsum4mi8
PubMed24443581
UniProtP89884|ARBH_MHV68 Apoptosis regulator Bcl-2 homolog (Gene Name=vBCL2)

[Back to BioLiP]